Lymphotoxin-beta, Recombinant, Pan troglodytes, aa49-244, His-SUMO-Tag

Catalog Number: USB-585238
Article Name: Lymphotoxin-beta, Recombinant, Pan troglodytes, aa49-244, His-SUMO-Tag
Biozol Catalog Number: USB-585238
Supplier Catalog Number: 585238
Alternative Catalog Number: USB-585238-20,USB-585238-100
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface. Source: Recombinant protein corresponding to aa49-244 from Pan troglodytes Lymphotoxin-beta, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~36.8kD Amino Acid Sequence: QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.8
UniProt: Q862Z7
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.