Lysozyme C, Recombinant, Chicken, aa19-147

Catalog Number: USB-585254
Article Name: Lysozyme C, Recombinant, Chicken, aa19-147
Biozol Catalog Number: USB-585254
Supplier Catalog Number: 585254
Alternative Catalog Number: USB-585254-20,USB-585254-100
Manufacturer: US Biological
Category: Molekularbiologie
Lysozymes have primarily a bacteriolytic function, those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Source: Recombinant protein corresponding to aa19-147 from chicken Lysozyme C, expressed in E.coli. Molecular Weight: ~14.4kD Amino Acid Sequence: KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.4
UniProt: P00698
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.