M13 Tail Virion Protein G9P, Recombinant, Enterobacteria phage, aa1-32, His-SUMO-Tag

Catalog Number: USB-585266
Article Name: M13 Tail Virion Protein G9P, Recombinant, Enterobacteria phage, aa1-32, His-SUMO-Tag
Biozol Catalog Number: USB-585266
Supplier Catalog Number: 585266
Alternative Catalog Number: USB-585266-20,USB-585266-100
Manufacturer: US Biological
Category: Molekularbiologie
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host. Source: Recombinant protein corresponding to aa1-32 from Enterobacteria phage M13 Tail virion protein G9P, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.7kD Amino Acid Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.7
UniProt: P69538
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.