Major Allergen Api g 1, isoallergen 2, Recombinant, Apium graveolens, aa1-159, His-Tag

Catalog Number: USB-585281
Article Name: Major Allergen Api g 1, isoallergen 2, Recombinant, Apium graveolens, aa1-159, His-Tag
Biozol Catalog Number: USB-585281
Supplier Catalog Number: 585281
Alternative Catalog Number: USB-585281-20,USB-585281-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-159 from Apium graveolens Major allergen Api g 1, isoallergen 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.1kD Amino Acid Sequence: MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.1
UniProt: P92918
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.