Major Allergen Dau c 1, Recombinant, Daucus carota, aa1-154, His-Tag

Product Overview

• Article Name: Major Allergen Dau c 1, Recombinant, Daucus carota, aa1-154, His-Tag
• Biozol Catalog Number: USB-585283
• Supplier Catalog Number: 585283
• Alternative Catalog Number: USB-585283-20,USB-585283-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-154 from Daucus carota Major allergen Dau c 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.1kD Amino Acid Sequence: MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.1
• UniProt: O04298
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.