Major Mite Allergen Der p 23, Recombinant, Dermatophagoides pteronyssinus, aa22-90, His-Tag

Product Overview

• Article Name: Major Mite Allergen Der p 23, Recombinant, Dermatophagoides pteronyssinus, aa22-90, His-Tag
• Biozol Catalog Number: USB-585295
• Supplier Catalog Number: 585295
• Alternative Catalog Number: USB-585295-20,USB-585295-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Does not bind chitin in vitro. Recombinant protein corresponding to aa22-90 from Dermatophagoides pteronyssinus Major mite allergen Der p 23, fused to 6X His-Tag at N-terminal, expressed in E.coli. Swiss/Uniprot: L7N6F8 Molecular Weight: ~13.0kD Amino Acid Sequence: ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 13
• UniProt: L7N6F8
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.