Major Outer Membrane Lipoprotein Lpp, Recombinant, Escherichia coli, aa21-78, His-KSI-Tag

Product Overview

• Article Name: Major Outer Membrane Lipoprotein Lpp, Recombinant, Escherichia coli, aa21-78, His-KSI-Tag
• Biozol Catalog Number: USB-585296
• Supplier Catalog Number: 585296
• Alternative Catalog Number: USB-585296-20,USB-585296-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope. Source: Recombinant protein corresponding to aa21-78 from Escherichia coli Major outer membrane lipoprotein Lpp, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.8kD Amino Acid Sequence: CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 21.8
• UniProt: P69776
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.