Major Outer Membrane Protein P.IB, Recombinant, Neisseria meningitidis serogroup B, aa20-331, His-Tag
Biozol Catalog Number:
USB-585302
Supplier Catalog Number:
585302
Alternative Catalog Number:
USB-585302-20,USB-585302-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Serves as a slightly cation selective porin. Source: Recombinant protein corresponding to aa20-331 from Neisseria meningitidis serogroup B Major outer membrane protein P.IB, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.8kD Amino Acid Sequence: DVTLYGTIKAGVETSRSVEHNGGQVVSVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGKYNSESYHAGFNYKNGGFFVQYGGAYKRHVRVDENVNIEKYQIHRLVSGYDNDALHASVAVQQQDAKLVEDNYSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSFDDADLSNDYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVSTAGGVGLRHKF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted