Major Pollen Allergen Dac g 4, Recombinant, Dactylis glomeRata, aa1-55, His-Tag
Biozol Catalog Number:
USB-585307
Supplier Catalog Number:
585307
Alternative Catalog Number:
USB-585307-20, USB-585307-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Source: Recombinant protein corresponding to aa1-55 from Dactylis glomeRata Major pollen allergen Dac g 4, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.4kD Amino Acid Sequence: DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.