Mast Cell Protease 1, Recombinant, Rat, aa21-260, Myc-Tag

Product Overview

• Article Name: Mast Cell Protease 1, Recombinant, Rat, aa21-260, Myc-Tag
• Biozol Catalog Number: USB-585328
• Supplier Catalog Number: 585328
• Alternative Catalog Number: USB-585328-20,USB-585328-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits. Source: Recombinant protein corresponding to aa21-260 from rat Mast cell protease 1, fused to Myc-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.6kD Amino Acid Sequence: IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 28.6
• UniProt: P09650
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.