Metallothionein-2, Recombinant, Human, aa1-59, GST-Tag

Catalog Number: USB-585381
Article Name: Metallothionein-2, Recombinant, Human, aa1-59, GST-Tag
Biozol Catalog Number: USB-585381
Supplier Catalog Number: 585381
Alternative Catalog Number: USB-585381-20, USB-585381-100
Manufacturer: US Biological
Category: Molekularbiologie
Metallothioneins have a high content of cysteine residues that bind various heavy metals, these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. Source: Recombinant protein corresponding to aa1-59 from human Metallothionein-2, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.9kD Amino Acid Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.9
UniProt: P02795
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.