Methyltransferase-like Protein 7B, Recombinant, Human, aa24-244, His-Tag

Catalog Number: USB-585394
Article Name: Methyltransferase-like Protein 7B, Recombinant, Human, aa24-244, His-Tag
Biozol Catalog Number: USB-585394
Supplier Catalog Number: 585394
Alternative Catalog Number: USB-585394-20, USB-585394-100
Manufacturer: US Biological
Category: Molekularbiologie
Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-l-methionine to hydrogen sulfide and other thiol compounds including dithiothreitol, 7alpha-thiospironolactone, L-penicillamine, and captopril. Source: Recombinant protein corresponding to aa24-244 from human Methyltransferase-like protein 7B, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.3kD Amino Acid Sequence: LLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.3
UniProt: Q6UX53
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.