Mite Allergen Der p 3, Recombinant, Dermatophagoides pteronyssinus, aa19-261, His-Tag

Catalog Number: USB-585408
Article Name: Mite Allergen Der p 3, Recombinant, Dermatophagoides pteronyssinus, aa19-261, His-Tag
Biozol Catalog Number: USB-585408
Supplier Catalog Number: 585408
Alternative Catalog Number: USB-585408-20,USB-585408-100,USB-585408-1
Manufacturer: US Biological
Category: Molekularbiologie
Full-length recombinant protein corresponding to aa19-261 from Dermatophagoides pteronyssinus Mite allergen Der p 3, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P39675 Molecular Weight: ~30.1kD Amino Acid Sequence: NPILPASPNATIVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.1
UniProt: P39675
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 10mM Tris-HCl, 1mM EDTA, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml