Mite Allergen Der p 3, Recombinant, Dermatophagoides pteronyssinus, aa30-261, His-SUMO-Tag

Catalog Number: USB-585409
Article Name: Mite Allergen Der p 3, Recombinant, Dermatophagoides pteronyssinus, aa30-261, His-SUMO-Tag
Biozol Catalog Number: USB-585409
Supplier Catalog Number: 585409
Alternative Catalog Number: USB-585409-20,USB-585409-100
Manufacturer: US Biological
Category: Molekularbiologie
Recombinant protein corresponding to aa30-261 from Dermatophagoides pteronyssinus Mite allergen Der p 3, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P39675 Molecular Weight: ~37.9kD Amino Acid Sequence: IVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.9
UniProt: P39675
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.