Mite Group 2 Allergen Tyr p 2, Recombinant, Tyrophagus putrescentiae, aa16-141, His-Tag

Product Overview

• Article Name: Mite Group 2 Allergen Tyr p 2, Recombinant, Tyrophagus putrescentiae, aa16-141, His-Tag
• Biozol Catalog Number: USB-585411
• Supplier Catalog Number: 585411
• Alternative Catalog Number: USB-585411-20,USB-585411-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa16-141 from Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.3kD Amino Acid Sequence: GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 17.3
• UniProt: O02380
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.