Mitogen-activated Protein Kinase Kinase Kinase 1, Recombinant, Mouse, aa1216-1493, His-Tag

Catalog Number: USB-585418
Article Name: Mitogen-activated Protein Kinase Kinase Kinase 1, Recombinant, Mouse, aa1216-1493, His-Tag
Biozol Catalog Number: USB-585418
Supplier Catalog Number: 585418
Alternative Catalog Number: USB-585418-20,USB-585418-100
Manufacturer: US Biological
Category: Molekularbiologie
Component of a protein kinase signal transduction cascade. Source: Recombinant protein corresponding to aa1216-1493 from mouse Mitogen-activated protein kinase kinase kinase 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~34.8kD Amino Acid Sequence: QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.8
UniProt: P53349
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.