mRNA Export Factor ICP27 Homolog, Recombinant, Human herpesvirus 6B, aa135-364, His-Tag, Myc-Tag

Catalog Number: USB-585430
Article Name: mRNA Export Factor ICP27 Homolog, Recombinant, Human herpesvirus 6B, aa135-364, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585430
Supplier Catalog Number: 585430
Alternative Catalog Number: USB-585430-20,USB-585430-100
Manufacturer: US Biological
Category: Molekularbiologie
Immediate early (EI) protein that plays many roles during productive infection including regulation of viral gene expression and nuclear export of intronless viral RNAs. Source: Recombinant protein corresponding to aa135-364 from human herpesvirus 6B mRNA export factor ICP27 homolog, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.6kD Amino Acid Sequence: CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.6
UniProt: P52539
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.