Muscarinic Acetylcholine Receptor M3, Recombinant, Human, aa253-492, His-B2M-Tag

Catalog Number: USB-585444
Article Name: Muscarinic Acetylcholine Receptor M3, Recombinant, Human, aa253-492, His-B2M-Tag
Biozol Catalog Number: USB-585444
Supplier Catalog Number: 585444
Alternative Catalog Number: USB-585444-20, USB-585444-100
Manufacturer: US Biological
Category: Molekularbiologie
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. Source: Recombinant protein corresponding to aa253-492 from human Muscarinic acetylcholine receptor M3, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~40.7kD Amino Acid Sequence: RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.7
UniProt: P20309
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol