Myocardin-related Transcription Factor A, Recombinant, Human, aa400-500, His-KSI-Tag

Product Overview

• Article Name: Myocardin-related Transcription Factor A, Recombinant, Human, aa400-500, His-KSI-Tag
• Biozol Catalog Number: USB-585452
• Supplier Catalog Number: 585452
• Alternative Catalog Number: USB-585452-20,USB-585452-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Transcription coactivator that associates with the serum response factor (SRF) transcription factor to control expression of genes regulating the cytoskeleton during development, morphogenesis and cell migration. The SRF-MRTFA complex activity responds to Rho GTPase-induced changes in cellular globular actin (G-actin) concentration, thereby coupling cytoskeletal gene expression to cytoskeletal dynamics. MRTFA binds G-actin via its RPEL repeats, regulating activity of the MRTFA-SRF complex. Activity is also regulated by filamentous actin (F-actin) in the nucleus. Source: Recombinant protein corresponding to aa400-500 from human Myocardin-related transcription factor A, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.4kD Amino Acid Sequence: LHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 25.4
• UniProt: Q969V6
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.