Myotrophin, Recombinant, Bovine, aa2-118, His-Tag

Catalog Number: USB-585461
Article Name: Myotrophin, Recombinant, Bovine, aa2-118, His-Tag
Biozol Catalog Number: USB-585461
Supplier Catalog Number: 585461
Alternative Catalog Number: USB-585461-20,USB-585461-100
Manufacturer: US Biological
Category: Molekularbiologie
Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer. Source: Recombinant protein corresponding to aa2-118 from bovine Myotrophin, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.2kD Amino Acid Sequence: CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.2
UniProt: Q3T0F7
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.