NADH Pyrophosphatase, Recombinant, E. coli O157:H7, aa1-257, His-Tag
Biozol Catalog Number:
USB-585476
Supplier Catalog Number:
585476
Alternative Catalog Number:
USB-585476-20, USB-585476-100
Manufacturer:
US Biological
Category:
Molekularbiologie
mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5 monophosphate mRNA. The NAD-cap is present at the 5-end of some mRNAs and stabilizes RNA against 5-processing. Has preference for mRNAs with a 5-end purine. Catalyzes the hydrolysis of a broad range of dinucleotide pyrophosphates. Source: Recombinant protein corresponding to aa1-257 from Escherichia coli O157:H7 NADH pyrophosphatase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.8kD Amino Acid Sequence: MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLIQQQRRYDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKHLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted