Natriuretic Peptides A, Recombinant, Human, aa78-115, His-Tag

Product Overview

• Article Name: Natriuretic Peptides A, Recombinant, Human, aa78-115, His-Tag
• Biozol Catalog Number: USB-585482
• Supplier Catalog Number: 585482
• Alternative Catalog Number: USB-585482-20,USB-585482-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Partial recombinant protein corresponding to aa78-115 from human Natriuretic peptides A, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/Uniprot Accession: P01160 Molecular Weight: ~5.9kD Amino Acid Sequence: PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 5.9
• UniProt: P01160
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.