Neuropeptide Y Receptor Type 2, Recombinant, Mouse, aa1-51, His-Tag

Product Overview

• Article Name: Neuropeptide Y Receptor Type 2, Recombinant, Mouse, aa1-51, His-Tag
• Biozol Catalog Number: USB-585512
• Supplier Catalog Number: 585512
• Alternative Catalog Number: USB-585512-20, USB-585512-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Receptor for neuropeptide Y and peptide YY. Source: Recombinant protein corresponding to aa1-51 from mouse Neuropeptide Y receptor type 2, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~11.0kD Amino Acid Sequence: MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 11
• UniProt: P97295
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.