Non-structural Glycoprotein 4, Recombinant, Rotavirus A, aa52-175, His-Tag, Myc-Tag

Catalog Number: USB-585537
Article Name: Non-structural Glycoprotein 4, Recombinant, Rotavirus A, aa52-175, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585537
Supplier Catalog Number: 585537
Alternative Catalog Number: USB-585537-20,USB-585537-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation (By similarity). Source: Recombinant protein corresponding to aa52-175 from Rotavirus A Non-structural glycoprotein 4, fused to 6X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~21.7kD Amino Acid Sequence: PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.7
UniProt: Q9PYC8
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.