Non-structural Protein 3b, Recombinant, Avian Infectious Bronchitis Virus, aa1-63, His-Tag
Biozol Catalog Number:
USB-585544
Supplier Catalog Number:
585544
Alternative Catalog Number:
USB-585544-20, USB-585544-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Source: Recombinant protein corresponding to aa1-63 from Avian infectious bronchitis virus Non-structural protein 3b, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~8.8kD Amino Acid Sequence: MLDFEAIIEAGEQLIQKISFDLQHISSVLNTQVFDPFEYCYYRGGSFWEIESAEEFSGDDEFT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted