Non-structural Protein 5b, Recombinant, Avian Infectious Bronchitis Virus, aa1-82, His-Tag
Biozol Catalog Number:
USB-585548
Supplier Catalog Number:
585548
Alternative Catalog Number:
USB-585548-20, USB-585548-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Involved in host translation shutoff without degradating host RNA. By suppressing host gene expression, facilitates the evasion from host type I interferon immune response. Source: Recombinant protein corresponding to aa1-82 from Avian infectious bronchitis virus Non-structural protein 5b, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~10.3kD Amino Acid Sequence: MNNSKDNPFRGAIARKARIYLREGLDCVYFLNKAGQAEPCPACTSLVFQGKTCEEHIHNNNLLSWQVVRQLERQTPQRQSSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted