Nucleoside Diphosphate Kinase B, Recombinant, Human, aa2-152, His-Tag, Myc-Tag

Catalog Number: USB-585611
Article Name: Nucleoside Diphosphate Kinase B, Recombinant, Human, aa2-152, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585611
Supplier Catalog Number: 585611
Alternative Catalog Number: USB-585611-20, USB-585611-100, USB-585611-1
Manufacturer: US Biological
Category: Molekularbiologie
Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene, binds DNA non-specifically Source: Recombinant protein corresponding to aa2-152 from human Nucleoside diphosphate kinase B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~24.2kD Amino Acid Sequence: ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.2
UniProt: P22392
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.