Odorant-binding Protein, Recombinant, Bovine, aa1-159

Catalog Number: USB-585624
Article Name: Odorant-binding Protein, Recombinant, Bovine, aa1-159
Biozol Catalog Number: USB-585624
Supplier Catalog Number: 585624
Alternative Catalog Number: USB-585624-20, USB-585624-100
Manufacturer: US Biological
Category: Molekularbiologie
This protein binds a wide variety of chemical odorants. Source: Recombinant protein corresponding to aa1-159 from bovine Odorant-binding protein, expressed in Yeast. Molecular Weight: ~18.5kD Amino Acid Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.5
UniProt: P07435
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.