Orexin Receptor Type 1, Recombinant, Human, aa1-46, His-Tag, Myc-Tag

Catalog Number: USB-585645
Article Name: Orexin Receptor Type 1, Recombinant, Human, aa1-46, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585645
Supplier Catalog Number: 585645
Alternative Catalog Number: USB-585645-20, USB-585645-100
Manufacturer: US Biological
Category: Molekularbiologie
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Source: Recombinant protein corresponding to aa1-46 from human Orexin receptor type 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~10.4kD Amino Acid Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 10.4
UniProt: O43613
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.