Outer Membrane Protein C, Recombinant, Klebsiella pneumoniae, aa22-363, His-Tag, Myc-Tag

Catalog Number: USB-585670
Article Name: Outer Membrane Protein C, Recombinant, Klebsiella pneumoniae, aa22-363, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585670
Supplier Catalog Number: 585670
Alternative Catalog Number: USB-585670-20,USB-585670-100
Manufacturer: US Biological
Category: Molekularbiologie
Forms pores that allow passive diffusion of small molecules across the outer membrane. In K.pneumoniae it has been shown to bind the C1Q component and activate the classical pathway of the complement system. Source: Recombinant protein corresponding to aa22-363 from Klebsiella pneumoniae Outer membrane protein C, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~45.0kD Amino Acid Sequence: AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 45
UniProt: Q48473
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.