Outer Membrane Protein MIP, Recombinant, Legionella longbeachae, aa21-233, His-Tag, Myc-Tag
Biozol Catalog Number:
USB-585671
Supplier Catalog Number:
585671
Alternative Catalog Number:
USB-585671-20,USB-585671-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity. Source: Recombinant protein corresponding to aa21-233 from Legionella longbeachae Outer membrane protein MIP, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~30.1kD Amino Acid Sequence: ATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAKGMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIPGWTEALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted