Outer Membrane Protein MIP, Recombinant, Legionella pneumophila, aa21-233, His-SUMO-Tag

Catalog Number: USB-585672
Article Name: Outer Membrane Protein MIP, Recombinant, Legionella pneumophila, aa21-233, His-SUMO-Tag
Biozol Catalog Number: USB-585672
Supplier Catalog Number: 585672
Alternative Catalog Number: USB-585672-20,USB-585672-100
Manufacturer: US Biological
Category: Molekularbiologie
Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity. Source: Recombinant protein corresponding to aa21-233 from Legionella pneumophila Outer membrane protein MIP, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.8kD Amino Acid Sequence: ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.8
UniProt: A5IGB8
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.