Outer Membrane Protein X, Recombinant, E. coli O157:H7, aa24-171, His-Tag, Myc-Tag

Product Overview

• Article Name: Outer Membrane Protein X, Recombinant, E. coli O157:H7, aa24-171, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-585675
• Supplier Catalog Number: 585675
• Alternative Catalog Number: USB-585675-20, USB-585675-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa24-171 from Escherichia coli O157:H7 Outer membrane protein X, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.8kD Amino Acid Sequence: ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 23.8
• UniProt: P0A919
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.