Outer Membrane Protein, Recombinant, E. coli, aa23-362, His-Tag, Myc-Tag

Product Overview

• Article Name: Outer Membrane Protein, Recombinant, E. coli, aa23-362, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-585677
• Supplier Catalog Number: 585677
• Alternative Catalog Number: USB-585677-20, USB-585677-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Forms pores that allow passive diffusion of small molecules across the outer membrane., (Microbial infection) It is also a receptor for the bacteriophage T2. Is the major receptor for colicin E5., (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536, polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity. Source: Recombinant protein corresponding to aa23-362 from Escherichia coli Outer membrane protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~44.1kD Amino Acid Sequence: AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 44.1
• UniProt: P02931
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.