Outer Membrane Virulence Protein YopE, Recombinant, Yersinia enterocolitica, aa1-219, His-SUMO-Tag

Product Overview

• Article Name: Outer Membrane Virulence Protein YopE, Recombinant, Yersinia enterocolitica, aa1-219, His-SUMO-Tag
• Biozol Catalog Number: USB-585678
• Supplier Catalog Number: 585678
• Alternative Catalog Number: USB-585678-20, USB-585678-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Essential virulence determinant, cytotoxic effector, involved in resistance to phagocytosis. Source: Recombinant protein corresponding to aa1-219 from Yersinia enterocolitica Outer membrane virulence protein YopE, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.9kD Amino Acid Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.9
• UniProt: P31492
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.