Outer Surface Protein A, Recombinant, Borrelia burgdorferi, aa17-273, His-Tag

Catalog Number: USB-585680
Article Name: Outer Surface Protein A, Recombinant, Borrelia burgdorferi, aa17-273, His-Tag
Biozol Catalog Number: USB-585680
Supplier Catalog Number: 585680
Alternative Catalog Number: USB-585680-20
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa17-273 from Borrelia burgdorferi Outer surface protein A, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.9kD Amino Acid Sequence: CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.9
UniProt: P0A3N6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.