Outer-membrane Lipoprotein Carrier Protein, Recombinant, E. coli O9:H4, aa22-203, His-Tag
Biozol Catalog Number:
USB-585682
Supplier Catalog Number:
585682
Alternative Catalog Number:
USB-585682-20, USB-585682-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane). Source: Recombinant protein corresponding to aa22-203 from Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.3kD Amino Acid Sequence: DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted