Oxytocin-neurophysin 1, Recombinant, Human, aa20-125, His-SUMOSTAR-Tag

Catalog Number: USB-585686
Article Name: Oxytocin-neurophysin 1, Recombinant, Human, aa20-125, His-SUMOSTAR-Tag
Biozol Catalog Number: USB-585686
Supplier Catalog Number: 585686
Alternative Catalog Number: USB-585686-20
Manufacturer: US Biological
Category: Molekularbiologie
Neurophysin 1 specifically binds oxytocin., Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). Source: Recombinant protein corresponding to aa20-125 from human Oxytocin-neurophysin 1, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.9kD Amino Acid Sequence: CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.9
UniProt: P01178
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.