P30 Adhesin, Recombinant, Mycoplasma pneumoniae, aa106-274, His-GST-Tag

Catalog Number: USB-585691
Article Name: P30 Adhesin, Recombinant, Mycoplasma pneumoniae, aa106-274, His-GST-Tag
Biozol Catalog Number: USB-585691
Supplier Catalog Number: 585691
Alternative Catalog Number: USB-585691-20,USB-585691-100
Manufacturer: US Biological
Category: Molekularbiologie
Adhesin necessary for successful cytadherence and virulence. Source: Recombinant protein corresponding to aa106-274 from Mycoplasma pneumoniae P30 adhesin, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~49.6kD Amino Acid Sequence: RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49.6
UniProt: P75330
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.