Pancreatic Beta Cell Growth Factor, Recombinant, Mesocricetus auratus, aa27-175, His-Tag

Catalog Number: USB-585694
Article Name: Pancreatic Beta Cell Growth Factor, Recombinant, Mesocricetus auratus, aa27-175, His-Tag
Biozol Catalog Number: USB-585694
Supplier Catalog Number: 585694
Alternative Catalog Number: USB-585694-20, USB-585694-100
Manufacturer: US Biological
Category: Molekularbiologie
Constituent of ilotropin, which is a partially purified preparation of cellophane wrapping (CW) pancreata. Capable of initiating duct cell proliferation, a prerequisite for islet neogenesis. Source: Recombinant protein corresponding to aa27-175 from Mesocricetus auratus Pancreatic beta cell growth factor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.8kD Amino Acid Sequence: EESQKKLPSSRITCPQGSVAYGSYCYSLILIPQTWSNAELSCQMHFSGHLAFLLSTGEITFVSSLVKNSLTAYQYIWIGLHDPSHGTLPNGSGWKWSSSNVLTFYNWERNPSIAADRGYCAVLSQKSGFQKWRDFNCENELPYICKFKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.8
UniProt: Q92778
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.