Penicillin-binding Protein 1A/1B, Recombinant, Bacillus subtilis, aa774-914, His-SUMO-Tag
Biozol Catalog Number:
USB-585705
Supplier Catalog Number:
585705
Alternative Catalog Number:
USB-585705-20, USB-585705-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits) (Probable). Required for vegetative growth (Probable). Has a partially redundant function with PBP-2A (pbpA) during spore outgrowth. Source: Recombinant protein corresponding to aa774-914 from Bacillus subtilis Penicillin-binding protein 1A/1B, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.4kD Amino Acid Sequence: AVSDDGKSTASTSYEVPKAEDDEDKKDQQQTDDEKQDDEKTQDDTQTDDSQKDDGQTDQDQTDDSTNDQDKKQDNTNTNPSDNNNQDQSNDNDNDNSNNQDTSDGDSNSGKNDSTGSDTNKNKTDTSNKTQTNSSSIEKTN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted