Pentatricopeptide Repeat-containing Protein At3g42630, Recombinant, Arabidopsis Thaliana, aa1-415, MBP-Tag, His-Tag

Catalog Number: USB-585706
Article Name: Pentatricopeptide Repeat-containing Protein At3g42630, Recombinant, Arabidopsis Thaliana, aa1-415, MBP-Tag, His-Tag
Biozol Catalog Number: USB-585706
Supplier Catalog Number: 585706
Alternative Catalog Number: USB-585706-20,USB-585706-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-415 from Arabidopsis thaliana Pentatricopeptide repeat-containing protein At3g42630, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~91.5kD Amino Acid Sequence: MLSLNLSLKPQHLKLLSCYTDSSAPSIAKKLIKESKLSRDFSQKIQIVDYAPLVQTLSQRRLPDVAHEIFLQTKSVNLLPNYRTLCALMLCFAENGFVLRARTIWDEIINSCFVPDVFVVSKLISAYEQFGCFDEVAKITKDVAARHSKLLPVVSSLAISCFGKNGQLELMEGVIEEMDSKGVLLEAETANVIVRYYSFFGSLDKMEKAYGRVKKFGIVIEEEEIRAVVLAYLKQRKFYRLREFLSDVGLGRRNLGNMLWNSVLLSYAADFKMKSLQREFIGMLDAGFSPDLTTFNIRALAFSRMALFWDLHLTLEHMRRLNIVPDLVTFGCVVDAYMDKRLARNLEFVYNRMNLDDSPLVLTDPLAFEVLGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 91.5
UniProt: Q9M2A1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.