Pericentrin, Recombinant, Mouse, aa2545-2810, His-Tag, Myc-Tag

Catalog Number: USB-585720
Article Name: Pericentrin, Recombinant, Mouse, aa2545-2810, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585720
Supplier Catalog Number: 585720
Alternative Catalog Number: USB-585720-20, USB-585720-100
Manufacturer: US Biological
Category: Molekularbiologie
Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material (PCM). May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome. Source: Recombinant protein corresponding to aa2545-2810 from mouse Pericentrin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~37.7kD Amino Acid Sequence: LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.7
UniProt: P48725
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol