Peroxiredoxin-1, Recombinant, Cricetulus griseus, aa2-199, His-Tag

Catalog Number: USB-585726
Article Name: Peroxiredoxin-1, Recombinant, Cricetulus griseus, aa2-199, His-Tag
Biozol Catalog Number: USB-585726
Supplier Catalog Number: 585726
Alternative Catalog Number: USB-585726-20, USB-585726-100
Manufacturer: US Biological
Category: Molekularbiologie
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. Source: Recombinant protein corresponding to aa2-199 from Cricetulus griseus Peroxiredoxin-1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.2kD Amino Acid Sequence: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.2
UniProt: Q9JKY1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.