Peroxisome Proliferator-activated Receptor alpha, Recombinant, Human, aa1-468, His-Tag, Myc-Tag

Catalog Number: USB-585733
Article Name: Peroxisome Proliferator-activated Receptor alpha, Recombinant, Human, aa1-468, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585733
Supplier Catalog Number: 585733
Alternative Catalog Number: USB-585733-20, USB-585733-100
Manufacturer: US Biological
Category: Molekularbiologie
Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine. Full length recombinant protein corresponding to aa1-468 from human Peroxisome proliferator-activated receptor alpha, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Swiss/Uniprot Accession: Q07869 Molecular Weight: ~56.2kD Amino Acid Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 56.2
UniProt: Q07869
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from Tris-HCL 1mM EDTA, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.