Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Source: Recombinant protein corresponding to aa1022-1155 from Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD Amino Acid Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
