Pesticidal Crystal Protein Cry1Fb, Recombinant, Bacillus thuringiensis subsp., aa984-1169, GST-Tag

Catalog Number: USB-585741
Article Name: Pesticidal Crystal Protein Cry1Fb, Recombinant, Bacillus thuringiensis subsp., aa984-1169, GST-Tag
Biozol Catalog Number: USB-585741
Supplier Catalog Number: 585741
Alternative Catalog Number: USB-585741-20,USB-585741-100
Manufacturer: US Biological
Category: Molekularbiologie
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. Source: Recombinant protein corresponding to aa984-1169 from Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~47.8kD Amino Acid Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.8
UniProt: O66377
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.