Phorbol-12-myristate-13-acetate-induced Protein 1, Recombinant, Mouse, aa1-103, His-Tag
Biozol Catalog Number:
USB-585752
Supplier Catalog Number:
585752
Alternative Catalog Number:
USB-585752-20,USB-585752-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1 (By similarity). Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1. Source: Recombinant protein corresponding to aa1-103 from mouse Phorbol-12-myristate-13-acetate-induced protein 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.6kD Amino Acid Sequence: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.