Phospholipase D LiSicTox-alphaIA1a, Recombinant, Loxosceles intermedia, aa27-306, His-Tag, Myc-Tag

Catalog Number: USB-585772
Article Name: Phospholipase D LiSicTox-alphaIA1a, Recombinant, Loxosceles intermedia, aa27-306, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585772
Supplier Catalog Number: 585772
Alternative Catalog Number: USB-585772-20,USB-585772-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the hydrolysis of sphingomyelin, lysophosphatidylcholine, and lyso-platelet activating factor but not that of phosphatidylcholine. Shows a high enzymatic activity. Induces dermonecrosis, blood vessel permeability and platelet aggregation. Source: Recombinant protein corresponding to aa27-306 from Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~38.7kD Amino Acid Sequence: AGNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDENPWVTFKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.7
UniProt: P0CE80
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.