Phosphoprotein p30, Recombinant, African Swine Fever Virus, aa1-204, His-Tag

Catalog Number: USB-585777
Article Name: Phosphoprotein p30, Recombinant, African Swine Fever Virus, aa1-204, His-Tag
Biozol Catalog Number: USB-585777
Supplier Catalog Number: 585777
Alternative Catalog Number: USB-585777-20,USB-585777-100
Manufacturer: US Biological
Category: Molekularbiologie
Modifies the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK) and may contribute to modulate HNRNPK functions related to processing and export of mRNAs during ASFV infection. Full length recombinant protein corresponding to aa1-204 from African swine fever virus Phosphoprotein p30, (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV), fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.6kD Amino Acid Sequence: MDFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.6
UniProt: P34204
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.